- Protein phosphatase 1F Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88206
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- Protein phosphatase 1F
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- CAMKP, CaMKPase, FEM-2, POPX2, hFEM-2
- This antibody was developed against Recombinant Protein corresponding to amino acids: VVPHQEVVGL VQSHLTRQQG SGLRVAEELV AAARERGSHD NITVMVVFLR DPQELLEGGN QGEGDPQAEG RRQDLPSSLP EPETQ
- 0.1 ml (also 25ul)
- Rabbit
- protein phosphatase, Mg2+/Mn2+ dependent 1F
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Apoptosis, Protein Phosphatase
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQ
Specifications/Features
Available conjugates: Unconjugated